Lineage for d3of6b2 (3of6 B:120-247)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2361850Domain d3of6b2: 3of6 B:120-247 [214331]
    Other proteins in same PDB: d3of6a1, d3of6b1, d3of6c1
    automated match to d1qsee2
    complexed with nag

Details for d3of6b2

PDB Entry: 3of6 (more details), 2.8 Å

PDB Description: human pre-t cell receptor crystal structure
PDB Compounds: (B:) T cell receptor beta chain

SCOPe Domain Sequences for d3of6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3of6b2 b.1.1.2 (B:120-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

SCOPe Domain Coordinates for d3of6b2:

Click to download the PDB-style file with coordinates for d3of6b2.
(The format of our PDB-style files is described here.)

Timeline for d3of6b2: