Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species Fab MAK33, (human), kappa L chain [49105] (1 PDB entry) |
Domain d1fh5h2: 1fh5 H:121-215 [21429] Other proteins in same PDB: d1fh5h1, d1fh5l1 |
PDB Entry: 1fh5 (more details), 2.9 Å
SCOP Domain Sequences for d1fh5h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fh5h2 b.1.1.2 (H:121-215) Immunoglobulin (constant domains of L and H chains) {Fab MAK33, (human), kappa L chain} akttppsvyplavtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtv tsstwpsetvtcnvahpasstkvdkkivpr
Timeline for d1fh5h2: