Lineage for d1fh5l2 (1fh5 L:109-214)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. Species Fab MAK33, (human), kappa L chain [49105] (1 PDB entry)
  8. Domain d1fh5l2: 1fh5 L:109-214 [21428]
    Other proteins in same PDB: d1fh5h1, d1fh5l1

Details for d1fh5l2

PDB Entry: 1fh5 (more details), 2.9 Å

PDB Description: crystal structure of the fab fragment of the monoclonal antibody mak33

SCOP Domain Sequences for d1fh5l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fh5l2 b.1.1.2 (L:109-214) Immunoglobulin (constant domains of L and H chains) {Fab MAK33, (human), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1fh5l2 are not available.

Timeline for d1fh5l2:

Domains from same chain:
(mouse over for more information)
d1fh5l1
Domains from other chains:
(mouse over for more information)
d1fh5h1, d1fh5h2