SCOPe 2.05: Domain d3oaul1: 3oau L:2-107

Lineage for d3oaul1 (3oau L:2-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (61 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody

8. Domain d3oaul1: 3oau L:2-107 [214272]
   Other proteins in same PDB: d3oaul2
   automated match to d1om3l1
   complexed with gol, so4

Details for d3oaul1

PDB Entry: 3oau, 1.9 Å

PDB Description: antibody 2g12 recognizes di-mannose equivalently in domain- and non- domain-exchanged forms, but only binds the hiv-1 glycan shield if domain-exchanged

PDB Compounds: (L:) FAB 2G12, light chain

SCOPe Domain Sequences for d3oaul1:

Sequence; same for both SEQRES and ATOM records:

>d3oaul1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
vvmtqspstlsasvgdtititcrasqsietwlawyqqkpgkapklliykastlktgvpsr
fsgsgsgteftltisglqfddfatyhcqhyagysatfgqgtrveik

Timeline for d3oaul1:

• d3oaul1 first appeared in SCOPe 2.03
  
• d3oaul1 appears in SCOPe 2.04
  
• d3oaul1 appears in SCOPe 2.06
  
• d3oaul1 appears in the current release, SCOPe 2.08