SCOPe 2.03: Domain d3oabd_: 3oab D:

Lineage for d3oabd_ (3oab D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.0: automated matches [196408] (1 protein)
   not a true family

6. Protein automated matches [196409] (21 species)
   not a true protein

7. Species Mentha x [TaxId:34256] [196410] (7 PDB entries)

8. Domain d3oabd_: 3oab D: [214271]
   automated match to d3oacd_
   complexed with dst, edo, ipe, mg, ppv; mutant

Details for d3oabd_

PDB Entry: 3oab, 2.3 Å

PDB Description: mint deletion mutant of heterotetrameric geranyl pyrophosphate synthase in complex with ligands

PDB Compounds: (D:) Geranyl diphosphate synthase large subunit

SCOPe Domain Sequences for d3oabd_:

Sequence; same for both SEQRES and ATOM records:

>d3oabd_ a.128.1.0 (D:) automated matches {Mentha x [TaxId: 34256]}
mfdfdgymlrkaksvnkaleaavqmkeplkihesmrysllaggkrvrpmlciaacelvgg
destampaacavemihtmslmhddlpcmdnddlrrgkptnhmafgesvavlagdallsfa
fehvaaatkgapperivrvlgelavsigseglvagqvvdvcsegmaevgldhlefihhhk
taallqgsvvlgailgggkeeevaklrkfancigllfqvvddildvtksskelgktagkd
lvadkttypkligvekskefadrlnreaqeqllhfhphraaplialanyiayrdn

Timeline for d3oabd_:

• d3oabd_ is new in SCOPe 2.03-stable
  
• d3oabd_ appears in SCOPe 2.04
  
• d3oabd_ appears in the current release, SCOPe 2.08, called d3oabd1