Lineage for d1f3dk2 (1f3d K:122-221)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289200Domain d1f3dk2: 1f3d K:122-221 [21427]
    Other proteins in same PDB: d1f3dh1, d1f3dj1, d1f3dj2, d1f3dk1, d1f3dl1, d1f3dl2
    part of catalytic Fab 4B2
    complexed with so4, tpm

Details for d1f3dk2

PDB Entry: 1f3d (more details), 1.87 Å

PDB Description: catalytic antibody 4b2 in complex with its amidinium hapten.

SCOP Domain Sequences for d1f3dk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3dk2 b.1.1.2 (K:122-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1f3dk2:

Click to download the PDB-style file with coordinates for d1f3dk2.
(The format of our PDB-style files is described here.)

Timeline for d1f3dk2: