Lineage for d1f3dh2 (1f3d H:122-223)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159463Species Catalytic Fab 4B2, (mouse), kappa L chain [49104] (1 PDB entry)
  8. 159464Domain d1f3dh2: 1f3d H:122-223 [21426]
    Other proteins in same PDB: d1f3dh1, d1f3dj1, d1f3dk1, d1f3dl1

Details for d1f3dh2

PDB Entry: 1f3d (more details), 1.87 Å

PDB Description: catalytic antibody 4b2 in complex with its amidinium hapten.

SCOP Domain Sequences for d1f3dh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3dh2 b.1.1.2 (H:122-223) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 4B2, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1f3dh2:

Click to download the PDB-style file with coordinates for d1f3dh2.
(The format of our PDB-style files is described here.)

Timeline for d1f3dh2: