Lineage for d3o9ra_ (3o9r A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010233Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 3010234Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 3010235Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 3010240Protein automated matches [190936] (7 species)
    not a true protein
  7. 3010248Species Influenza A virus (a/udorn/307/1972(h3n2)) [TaxId:381517] [188730] (12 PDB entries)
  8. 3010252Domain d3o9ra_: 3o9r A: [214253]
    automated match to d3kwgb_
    mutant

Details for d3o9ra_

PDB Entry: 3o9r (more details), 2 Å

PDB Description: Effector domain of NS1 from influenza A/PR/8/34 containing a W187A mutation
PDB Compounds: (A:) nonstructural protein 1

SCOPe Domain Sequences for d3o9ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o9ra_ d.299.1.1 (A:) automated matches {Influenza A virus (a/udorn/307/1972(h3n2)) [TaxId: 381517]}
asryltdmtleemsrdwsmlipkqkvagplcirmdqaimdkniilkanfsvifdrletli
llrafteegaivgeisplpslpghtaedvknavgvliggleandntvrvsetlqrfaw

SCOPe Domain Coordinates for d3o9ra_:

Click to download the PDB-style file with coordinates for d3o9ra_.
(The format of our PDB-style files is described here.)

Timeline for d3o9ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3o9rb_