Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Catalytic Fab 4B2, (mouse), kappa L chain [49104] (1 PDB entry) |
Domain d1f3dj2: 1f3d J:108-213 [21425] Other proteins in same PDB: d1f3dh1, d1f3dj1, d1f3dk1, d1f3dl1 |
PDB Entry: 1f3d (more details), 1.87 Å
SCOP Domain Sequences for d1f3dj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3dj2 b.1.1.2 (J:108-213) Immunoglobulin (constant domains of L and H chains) {Catalytic Fab 4B2, (mouse), kappa L chain} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrna
Timeline for d1f3dj2: