SCOP 1.73: Domain d1f11d2: 1f11 D:114-227

Lineage for d1f11d2 (1f11 D:114-227)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1f11d2: 1f11 D:114-227 [21423]
   Other proteins in same PDB: d1f11a1, d1f11a2, d1f11b1, d1f11c1, d1f11c2, d1f11d1
   part of anti-Pres2 Fab F124

Details for d1f11d2

PDB Entry: 1f11, 3 Å

PDB Description: f124 fab fragment from a monoclonal anti-pres2 antibody

PDB Compounds: (D:) f124 immunoglobulin (igg1 heavy chain)

SCOP Domain Sequences for d1f11d2:

Sequence; same for both SEQRES and ATOM records:

>d1f11d2 b.1.1.2 (D:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

Timeline for d1f11d2:

• d1f11d2 first appeared (with stable ids) in SCOP 1.55
  
• d1f11d2 appears in SCOP 1.71
  
• d1f11d2 appears in SCOP 1.75
  
• d1f11d2 appears in the current release, SCOPe 2.08