Lineage for d1f11d2 (1f11 D:114-227)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8547Species Anti-Pres2 Fab F124, (mouse), kappa L chain [49103] (1 PDB entry)
  8. 8551Domain d1f11d2: 1f11 D:114-227 [21423]
    Other proteins in same PDB: d1f11a1, d1f11b1, d1f11c1, d1f11d1

Details for d1f11d2

PDB Entry: 1f11 (more details), 3 Å

PDB Description: f124 fab fragment from a monoclonal anti-pres2 antibody

SCOP Domain Sequences for d1f11d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f11d2 b.1.1.2 (D:114-227) Immunoglobulin (constant domains of L and H chains) {Anti-Pres2 Fab F124, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1f11d2:

Click to download the PDB-style file with coordinates for d1f11d2.
(The format of our PDB-style files is described here.)

Timeline for d1f11d2: