Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [188287] (16 PDB entries) |
Domain d3o81a_: 3o81 A: [214226] automated match to d2yf6b_ |
PDB Entry: 3o81 (more details), 2 Å
SCOPe Domain Sequences for d3o81a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o81a_ b.1.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} adltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddw tfqrlvhadftpssgstyackvehetlkepqvykwdp
Timeline for d3o81a_: