Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [225987] (9 PDB entries) |
Domain d3o80a2: 3o80 A:224-485 [214225] automated match to d1ig8a2 complexed with anp |
PDB Entry: 3o80 (more details), 2.18 Å
SCOPe Domain Sequences for d3o80a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o80a2 c.55.1.0 (A:224-485) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]} qtkmgiiigtgvngayydvvsgieklegllpedigpdspmainceygsfdnehlvlprtk ydviideesprpgqqafekmtsgyylgeimrlvlldlydsgfifkdqdisklkeayvmdt sypskieddpfenledtddlfktnlniettvverklirklaelvgtraarltvcgvsaic dkrgyktahiaadgsvfnrypgykekaaqalkdiynwdvekmedhpiqlvaaedgsgvga aiiacltqkrlaagksvgikge
Timeline for d3o80a2: