Lineage for d3o76b1 (3o76 B:1-78)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852841Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1853156Protein Class pi GST [81358] (4 species)
  7. 1853271Species Mouse (Mus musculus) [TaxId:10090] [52866] (9 PDB entries)
  8. 1853275Domain d3o76b1: 3o76 B:1-78 [214222]
    Other proteins in same PDB: d3o76a2, d3o76b2
    automated match to d1gssa2
    complexed with gtb; mutant

Details for d3o76b1

PDB Entry: 3o76 (more details), 1.77 Å

PDB Description: 1.8 Angstroms molecular structure of mouse liver glutathione S-transferase mutant C47A complexed with S-(P-nitrobenzyl)glutathione
PDB Compounds: (B:) Glutathione S-transferase P 1

SCOPe Domain Sequences for d3o76b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o76b1 c.47.1.5 (B:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptalygqlpkfedgdl
tlyqsnailrhlgrslgl

SCOPe Domain Coordinates for d3o76b1:

Click to download the PDB-style file with coordinates for d3o76b1.
(The format of our PDB-style files is described here.)

Timeline for d3o76b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3o76b2