SCOP 1.55: Domain d1f11c2: 1f11 C:108-212

Lineage for d1f11c2 (1f11 C:108-212)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Anti-Pres2 Fab F124, (mouse), kappa L chain [49103] (1 PDB entry)

8. Domain d1f11c2: 1f11 C:108-212 [21422]
   Other proteins in same PDB: d1f11a1, d1f11b1, d1f11c1, d1f11d1

Details for d1f11c2

PDB Entry: 1f11, 3 Å

PDB Description: f124 fab fragment from a monoclonal anti-pres2 antibody

SCOP Domain Sequences for d1f11c2:

Sequence; same for both SEQRES and ATOM records:

>d1f11c2 b.1.1.2 (C:108-212) Immunoglobulin (constant domains of L and H chains) {Anti-Pres2 Fab F124, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d1f11c2:

• d1f11c2 appears in SCOP 1.57
  
• d1f11c2 appears in the current release, SCOPe 2.08