SCOPe 2.08: Domain d3o6fh2: 3o6f H:116-243

Lineage for d3o6fh2 (3o6f H:116-243)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)

8. Domain d3o6fh2: 3o6f H:116-243 [214211]
   Other proteins in same PDB: d3o6fa1, d3o6fa2, d3o6fa3, d3o6fc1, d3o6fc2, d3o6fd1, d3o6fe1, d3o6fe2, d3o6fg1, d3o6fg2, d3o6fh1
   automated match to d1ktke2

Details for d3o6fh2

PDB Entry: 3o6f, 2.8 Å

PDB Description: crystal structure of a human autoimmune tcr ms2-3c8 bound to mhc class ii self-ligand mbp/hla-dr4

PDB Compounds: (H:) T-cell receptor beta-1 chain C region

SCOPe Domain Sequences for d3o6fh2:

Sequence; same for both SEQRES and ATOM records:

>d3o6fh2 b.1.1.2 (H:116-243) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d3o6fh2:

• d3o6fh2 first appeared in SCOPe 2.03
  
• d3o6fh2 appears in SCOPe 2.07