Lineage for d3o6fh1 (3o6f H:1-115)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520142Domain d3o6fh1: 3o6f H:1-115 [214210]
    Other proteins in same PDB: d3o6fa1, d3o6fa2, d3o6fc2, d3o6fd2, d3o6fe1, d3o6fe2, d3o6fg2, d3o6fh2
    automated match to d1ktke1

Details for d3o6fh1

PDB Entry: 3o6f (more details), 2.8 Å

PDB Description: crystal structure of a human autoimmune tcr ms2-3c8 bound to mhc class ii self-ligand mbp/hla-dr4
PDB Compounds: (H:) T-cell receptor beta-1 chain C region

SCOPe Domain Sequences for d3o6fh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o6fh1 b.1.1.0 (H:1-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvsqhpswviaksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsnegskatyeqgv
ekdkflinhasltlstltvtsahpedssfyicsarggsynsplhfgngtrltvte

SCOPe Domain Coordinates for d3o6fh1:

Click to download the PDB-style file with coordinates for d3o6fh1.
(The format of our PDB-style files is described here.)

Timeline for d3o6fh1: