SCOPe 2.03: Domain d1f11b2: 1f11 B:114-227

Lineage for d1f11b2 (1f11 B:114-227)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (414 PDB entries)
   Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form

8. Domain d1f11b2: 1f11 B:114-227 [21421]
   Other proteins in same PDB: d1f11a1, d1f11a2, d1f11b1, d1f11c1, d1f11c2, d1f11d1
   part of anti-Pres2 Fab F124

Details for d1f11b2

PDB Entry: 1f11, 3 Å

PDB Description: f124 fab fragment from a monoclonal anti-pres2 antibody

PDB Compounds: (B:) f124 immunoglobulin (igg1 heavy chain)

SCOPe Domain Sequences for d1f11b2:

Sequence; same for both SEQRES and ATOM records:

>d1f11b2 b.1.1.2 (B:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

Timeline for d1f11b2:

• d1f11b2 first appeared (with stable ids) in SCOP 1.55
  
• d1f11b2 appears in SCOPe 2.02
  
• d1f11b2 appears in SCOPe 2.04
  
• d1f11b2 appears in the current release, SCOPe 2.08