SCOPe 2.05: Domain d3o6fg2: 3o6f G:111-196

Lineage for d3o6fg2 (3o6f G:111-196)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d3o6fg2: 3o6f G:111-196 [214209]
   Other proteins in same PDB: d3o6fa1, d3o6fa2, d3o6fc1, d3o6fd1, d3o6fd2, d3o6fe1, d3o6fe2, d3o6fg1, d3o6fh1, d3o6fh2
   automated match to d1nfda2

Details for d3o6fg2

PDB Entry: 3o6f, 2.8 Å

PDB Description: crystal structure of a human autoimmune tcr ms2-3c8 bound to mhc class ii self-ligand mbp/hla-dr4

PDB Compounds: (G:) T-cell receptor alpha chain c region

SCOPe Domain Sequences for d3o6fg2:

Sequence, based on SEQRES records:

>d3o6fg2 b.1.1.2 (G:111-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Sequence, based on observed residues (ATOM records):

>d3o6fg2 b.1.1.2 (G:111-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdkvclftdfdsqtnvsqdvyitdktvldmrsmdfksnsavaws
nksdfacannsiipedtf

Timeline for d3o6fg2:

• d3o6fg2 first appeared in SCOPe 2.03
  
• d3o6fg2 appears in SCOPe 2.04
  
• d3o6fg2 appears in SCOPe 2.06
  
• d3o6fg2 appears in the current release, SCOPe 2.08