Lineage for d3o6fg1 (3o6f G:1-110)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296644Domain d3o6fg1: 3o6f G:1-110 [214208]
    Other proteins in same PDB: d3o6fa1, d3o6fa2, d3o6fc2, d3o6fd2, d3o6fe1, d3o6fe2, d3o6fg2, d3o6fh2
    automated match to d1nfda1

Details for d3o6fg1

PDB Entry: 3o6f (more details), 2.8 Å

PDB Description: crystal structure of a human autoimmune tcr ms2-3c8 bound to mhc class ii self-ligand mbp/hla-dr4
PDB Compounds: (G:) T-cell receptor alpha chain c region

SCOPe Domain Sequences for d3o6fg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o6fg1 b.1.1.0 (G:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrmas
laiaedrksstlilhratlrdaavyyctvyggatnklifgtgtllavqpn

SCOPe Domain Coordinates for d3o6fg1:

Click to download the PDB-style file with coordinates for d3o6fg1.
(The format of our PDB-style files is described here.)

Timeline for d3o6fg1: