Lineage for d3o6fe2 (3o6f E:82-180)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760280Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1760288Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 1760336Domain d3o6fe2: 3o6f E:82-180 [214207]
    Other proteins in same PDB: d3o6fa1, d3o6fc1, d3o6fc2, d3o6fd1, d3o6fd2, d3o6fe1, d3o6fg1, d3o6fg2, d3o6fh1, d3o6fh2
    automated match to d1jwua1

Details for d3o6fe2

PDB Entry: 3o6f (more details), 2.8 Å

PDB Description: crystal structure of a human autoimmune tcr ms2-3c8 bound to mhc class ii self-ligand mbp/hla-dr4
PDB Compounds: (E:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d3o6fe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o6fe2 b.1.1.2 (E:82-180) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

SCOPe Domain Coordinates for d3o6fe2:

Click to download the PDB-style file with coordinates for d3o6fe2.
(The format of our PDB-style files is described here.)

Timeline for d3o6fe2: