SCOPe 2.05: Domain d3o6fd1: 3o6f D:1-115

Lineage for d3o6fd1 (3o6f D:1-115)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d3o6fd1: 3o6f D:1-115 [214204]
   Other proteins in same PDB: d3o6fa1, d3o6fa2, d3o6fc2, d3o6fd2, d3o6fe1, d3o6fe2, d3o6fg2, d3o6fh2
   automated match to d1ktke1

Details for d3o6fd1

PDB Entry: 3o6f, 2.8 Å

PDB Description: crystal structure of a human autoimmune tcr ms2-3c8 bound to mhc class ii self-ligand mbp/hla-dr4

PDB Compounds: (D:) T-cell receptor beta-1 chain C region

SCOPe Domain Sequences for d3o6fd1:

Sequence; same for both SEQRES and ATOM records:

>d3o6fd1 b.1.1.0 (D:1-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvsqhpswviaksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsnegskatyeqgv
ekdkflinhasltlstltvtsahpedssfyicsarggsynsplhfgngtrltvte

Timeline for d3o6fd1:

• d3o6fd1 first appeared in SCOPe 2.03
  
• d3o6fd1 appears in SCOPe 2.04
  
• d3o6fd1 appears in SCOPe 2.06
  
• d3o6fd1 appears in the current release, SCOPe 2.08