![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (16 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
![]() | Domain d3o6fc2: 3o6f C:111-196 [214203] Other proteins in same PDB: d3o6fa1, d3o6fa2, d3o6fc1, d3o6fd1, d3o6fd2, d3o6fe1, d3o6fe2, d3o6fg1, d3o6fh1, d3o6fh2 automated match to d1nfda2 |
PDB Entry: 3o6f (more details), 2.8 Å
SCOPe Domain Sequences for d3o6fc2:
Sequence, based on SEQRES records: (download)
>d3o6fc2 b.1.1.2 (C:111-196) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns avawsnksdfacanafnnsiipedtf
>d3o6fc2 b.1.1.2 (C:111-196) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdkvclftdfdsqtnvsskdsdvyitdktvldmrsmdfksnsav awsnksdfacannsiipedtf
Timeline for d3o6fc2: