Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88571] (20 PDB entries) |
Domain d1f4yl2: 1f4y L:111-210 [21418] Other proteins in same PDB: d1f4yh1, d1f4yh2, d1f4yl1 part of anti-carbohydrate Fab S-20-4 complexed with mgu |
PDB Entry: 1f4y (more details), 2.8 Å
SCOP Domain Sequences for d1f4yl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4yl2 b.1.1.2 (L:111-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)} qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq snnkymassyltltarawerhssyscqvtheghtveksls
Timeline for d1f4yl2: