Lineage for d1f4yl2 (1f4y L:111-210)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 220897Species Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain [49102] (3 PDB entries)
  8. 220903Domain d1f4yl2: 1f4y L:111-210 [21418]
    Other proteins in same PDB: d1f4yh1, d1f4yl1

Details for d1f4yl2

PDB Entry: 1f4y (more details), 2.8 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen

SCOP Domain Sequences for d1f4yl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4yl2 b.1.1.2 (L:111-210) Immunoglobulin (constant domains of L and H chains) {Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtveksls

SCOP Domain Coordinates for d1f4yl2:

Click to download the PDB-style file with coordinates for d1f4yl2.
(The format of our PDB-style files is described here.)

Timeline for d1f4yl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f4yl1