Lineage for d3o4rd_ (3o4r D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107789Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)
  8. 2107799Domain d3o4rd_: 3o4r D: [214160]
    automated match to d2p68b_
    complexed with edo, epe, gol, nap

Details for d3o4rd_

PDB Entry: 3o4r (more details), 1.7 Å

PDB Description: crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
PDB Compounds: (D:) Dehydrogenase/reductase SDR family member 4

SCOPe Domain Sequences for d3o4rd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o4rd_ c.2.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dplankvalvtastdgigfaiarrlaqdgahvvvssrkqqnvdqavatlqgeglsvtgtv
chvgkaedrerlvatavklhggidilvsnaavnpffgsimdvteevwdktldinvkapal
mtkavvpemekrgggsvvivssiaafspspgfspynvsktallgltktlaielaprnirv
nclapgliktsfsrmlwmdkekeesmketlrirrlgepedcagivsflcsedasyitget
vvvgggtpsrl

SCOPe Domain Coordinates for d3o4rd_:

Click to download the PDB-style file with coordinates for d3o4rd_.
(The format of our PDB-style files is described here.)

Timeline for d3o4rd_: