Lineage for d1f4wl2 (1f4w L:111-210)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103668Species Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain [49102] (3 PDB entries)
  8. 103672Domain d1f4wl2: 1f4w L:111-210 [21416]
    Other proteins in same PDB: d1f4wh1, d1f4wl1

Details for d1f4wl2

PDB Entry: 1f4w (more details), 2.3 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen

SCOP Domain Sequences for d1f4wl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4wl2 b.1.1.2 (L:111-210) Immunoglobulin (constant domains of L and H chains) {Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettnpskq
snnkymassyltltarawerhssyscqvtheghtveksls

SCOP Domain Coordinates for d1f4wl2:

Click to download the PDB-style file with coordinates for d1f4wl2.
(The format of our PDB-style files is described here.)

Timeline for d1f4wl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f4wl1