SCOPe 2.06: Domain d3o4rc_: 3o4r C:

Lineage for d3o4rc_ (3o4r C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)

8. Domain d3o4rc_: 3o4r C: [214159]
   automated match to d2p68b_
   complexed with edo, epe, gol, nap

Details for d3o4rc_

PDB Entry: 3o4r, 1.7 Å

PDB Description: crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)

PDB Compounds: (C:) Dehydrogenase/reductase SDR family member 4

SCOPe Domain Sequences for d3o4rc_:

Sequence; same for both SEQRES and ATOM records:

>d3o4rc_ c.2.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrdplankvalvtastdgigfaiarrlaqdgahvvvssrkqqnvdqavatlqgeglsvtg
tvchvgkaedrerlvatavklhggidilvsnaavnpffgsimdvteevwdktldinvkap
almtkavvpemekrgggsvvivssiaafspspgfspynvsktallgltktlaielaprni
rvnclapgliktsfsrmlwmdkekeesmketlrirrlgepedcagivsflcsedasyitg
etvvvgggtpsrl

Timeline for d3o4rc_:

• d3o4rc_ first appeared in SCOPe 2.03
  
• d3o4rc_ appears in SCOPe 2.05
  
• d3o4rc_ appears in SCOPe 2.07
  
• d3o4rc_ appears in the current release, SCOPe 2.08