Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries) |
Domain d3o4rb_: 3o4r B: [214158] automated match to d2p68b_ complexed with edo, epe, gol, nap |
PDB Entry: 3o4r (more details), 1.7 Å
SCOPe Domain Sequences for d3o4rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o4rb_ c.2.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rdplankvalvtastdgigfaiarrlaqdgahvvvssrkqqnvdqavatlqgeglsvtgt vchvgkaedrerlvatavklhggidilvsnaavnpffgsimdvteevwdktldinvkapa lmtkavvpemekrgggsvvivssiaafspspgfspynvsktallgltktlaielaprnir vnclapgliktsfsrmlwmdkekeesmketlrirrlgepedcagivsflcsedasyitge tvvvgggtpsrl
Timeline for d3o4rb_: