Lineage for d3o4fc_ (3o4f C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146686Species Escherichia coli K-12 [TaxId:83333] [196426] (7 PDB entries)
  8. 2146699Domain d3o4fc_: 3o4f C: [214143]
    automated match to d2o06a_
    complexed with so4

Details for d3o4fc_

PDB Entry: 3o4f (more details), 2.9 Å

PDB Description: crystal structure of spermidine synthase from e. coli
PDB Compounds: (C:) spermidine synthase

SCOPe Domain Sequences for d3o4fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o4fc_ c.66.1.0 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kkqwhetlhdqfgqyfavdnvlyhektdhqdliifenaafgrvmaldgvvqtterdefiy
hemmthvpllahghakhvliigggdgamlrevtrhknvesitmveidagvvsfcrqylpn
hnagsyddprfklviddgvnfvnqtsqtfdviisdctdpigpgeslftsafyegckrcln
pggifvaqngvcflqqeeaidshrklshyfsdvgfyqaaiptyyggimtfawatdndalr
hlsteiiqarflasglkcryynpaihtaafalpqylqdalasqp

SCOPe Domain Coordinates for d3o4fc_:

Click to download the PDB-style file with coordinates for d3o4fc_.
(The format of our PDB-style files is described here.)

Timeline for d3o4fc_: