Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries) |
Domain d3o2wl2: 3o2w L:108-213 [214131] Other proteins in same PDB: d3o2wl1 automated match to d1t66c2 complexed with flc, o2w, so4, trs |
PDB Entry: 3o2w (more details), 2.55 Å
SCOPe Domain Sequences for d3o2wl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o2wl2 b.1.1.0 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d3o2wl2: