SCOPe 2.06: Domain d3o2wl1: 3o2w L:1-107

Lineage for d3o2wl1 (3o2w L:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)

8. Domain d3o2wl1: 3o2w L:1-107 [214130]
   Other proteins in same PDB: d3o2wl2
   automated match to d1t66c1
   complexed with flc, o2w, so4, trs

Details for d3o2wl1

PDB Entry: 3o2w, 2.55 Å

PDB Description: Crystal structure of the 1E9 PheL89Ser/LeuH47Trp/MetH100bPhe Fab in complex with a 39A11 transition state analog

PDB Compounds: (L:) Chimeric antibody Fab 1E9, light chain

SCOPe Domain Sequences for d3o2wl1:

Sequence; same for both SEQRES and ATOM records:

>d3o2wl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspkfliykvsnrf
sgvpdrfsgsgsgtdfilkisrveaedlgvyfcsqsthffptfgggtkleik

Timeline for d3o2wl1:

• d3o2wl1 first appeared in SCOPe 2.03
  
• d3o2wl1 appears in SCOPe 2.05
  
• d3o2wl1 appears in SCOPe 2.07
  
• d3o2wl1 appears in the current release, SCOPe 2.08