SCOPe 2.07: Domain d3o13a2: 3o13 A:125-227

Lineage for d3o13a2 (3o13 A:125-227)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [224923] (3 PDB entries)

8. Domain d3o13a2: 3o13 A:125-227 [214114]
   Other proteins in same PDB: d3o13a1
   automated match to d1v1pa2
   complexed with cl, edo

Details for d3o13a2

PDB Entry: 3o13, 2.05 Å

PDB Description: Crystal structure of a superantigen-like protein (SAV0433) from Staphylococcus aureus MU50 at 2.05 A resolution

PDB Compounds: (A:) Superantigen-like protein

SCOPe Domain Sequences for d3o13a2:

Sequence, based on SEQRES records:

>d3o13a2 d.15.6.0 (A:125-227) automated matches {Staphylococcus aureus [TaxId: 158878]}
hkdtvqnvnlsvskstgqhttsvtseyysiykeeislkeldfklrkhlidkhdlyktepk
dskiritmknggyytfelnkklqphrmgdtidsrniekievnl

Sequence, based on observed residues (ATOM records):

>d3o13a2 d.15.6.0 (A:125-227) automated matches {Staphylococcus aureus [TaxId: 158878]}
hkdtvqnvnlsvskstsvtseyysiykeeislkeldfklrkhlidkhdlyktepkdskir
itmknggyytfelnkklqphrmgdtidsrniekievnl

Timeline for d3o13a2:

• d3o13a2 first appeared in SCOPe 2.03
  
• d3o13a2 appears in SCOPe 2.06
  
• d3o13a2 appears in the current release, SCOPe 2.08