Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
Protein automated matches [226841] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [224923] (3 PDB entries) |
Domain d3o13a2: 3o13 A:125-227 [214114] Other proteins in same PDB: d3o13a1 automated match to d1v1pa2 complexed with cl, edo |
PDB Entry: 3o13 (more details), 2.05 Å
SCOPe Domain Sequences for d3o13a2:
Sequence, based on SEQRES records: (download)
>d3o13a2 d.15.6.0 (A:125-227) automated matches {Staphylococcus aureus [TaxId: 158878]} hkdtvqnvnlsvskstgqhttsvtseyysiykeeislkeldfklrkhlidkhdlyktepk dskiritmknggyytfelnkklqphrmgdtidsrniekievnl
>d3o13a2 d.15.6.0 (A:125-227) automated matches {Staphylococcus aureus [TaxId: 158878]} hkdtvqnvnlsvskstsvtseyysiykeeislkeldfklrkhlidkhdlyktepkdskir itmknggyytfelnkklqphrmgdtidsrniekievnl
Timeline for d3o13a2: