Lineage for d3o11l1 (3o11 L:1-105)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520964Domain d3o11l1: 3o11 L:1-105 [214111]
    Other proteins in same PDB: d3o11a2, d3o11l2
    automated match to d1rhha1

Details for d3o11l1

PDB Entry: 3o11 (more details), 2.8 Å

PDB Description: anti-beta-amyloid antibody c706 fab in space group c2
PDB Compounds: (L:) C706 LIGHT CHAIN variable region, Ig kappa chain C region chimera

SCOPe Domain Sequences for d3o11l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o11l1 b.1.1.0 (L:1-105) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydssrlasgvpsr
fsgggsgtsysltisnmeaedaatyfcqnwrssptfgagtklelk

SCOPe Domain Coordinates for d3o11l1:

Click to download the PDB-style file with coordinates for d3o11l1.
(The format of our PDB-style files is described here.)

Timeline for d3o11l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3o11l2