SCOP 1.55: Domain d1deed2: 1dee D:1622-1723

Lineage for d1deed2 (1dee D:1622-1723)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab of human IgM RF 2A2 [49101] (1 PDB entry)

8. Domain d1deed2: 1dee D:1622-1723 [21411]
   Other proteins in same PDB: d1deea1, d1deeb1, d1deec1, d1deed1, d1deee1, d1deef1, d1deeg_, d1deeh_

Details for d1deed2

PDB Entry: 1dee, 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab

SCOP Domain Sequences for d1deed2:

Sequence; same for both SEQRES and ATOM records:

>d1deed2 b.1.1.2 (D:1622-1723) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvpl

Timeline for d1deed2:

• d1deed2 appears in SCOP 1.57
  
• d1deed2 appears in the current release, SCOPe 2.08