Lineage for d3o0ja_ (3o0j A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2737088Protein automated matches [190370] (2 species)
    not a true protein
  7. 2737094Species Human (Homo sapiens) [TaxId:9606] [187208] (27 PDB entries)
  8. 2737097Domain d3o0ja_: 3o0j A: [214102]
    automated match to d1xmua_
    complexed with 3oj, edo, mg, zn

Details for d3o0ja_

PDB Entry: 3o0j (more details), 1.95 Å

PDB Description: PDE4B In complex with ligand an2898
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d3o0ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o0ja_ a.211.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymm
tledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgv
snqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidm
vlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptksle
lyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadl
vqpdaqdildtlednrnwyqsmi

SCOPe Domain Coordinates for d3o0ja_:

Click to download the PDB-style file with coordinates for d3o0ja_.
(The format of our PDB-style files is described here.)

Timeline for d3o0ja_: