Lineage for d1deeb2 (1dee B:622-723)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9083Species Fab of human IgM RF 2A2 [49101] (1 PDB entry)
  8. 9085Domain d1deeb2: 1dee B:622-723 [21409]
    Other proteins in same PDB: d1deea1, d1deeb1, d1deec1, d1deed1, d1deee1, d1deef1, d1deeg_, d1deeh_

Details for d1deeb2

PDB Entry: 1dee (more details), 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab

SCOP Domain Sequences for d1deeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deeb2 b.1.1.2 (B:622-723) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvpl

SCOP Domain Coordinates for d1deeb2:

Click to download the PDB-style file with coordinates for d1deeb2.
(The format of our PDB-style files is described here.)

Timeline for d1deeb2: