Lineage for d1dqdl2 (1dqd L:107-214)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454153Domain d1dqdl2: 1dqd L:107-214 [21406]
    Other proteins in same PDB: d1dqdh1, d1dqdh2, d1dqdl1
    part of Fab HGR-2 F6, a competitive antagonist of the glucagon receptor

Details for d1dqdl2

PDB Entry: 1dqd (more details), 2.1 Å

PDB Description: crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor

SCOP Domain Sequences for d1dqdl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqdl2 b.1.1.2 (L:107-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrneca

SCOP Domain Coordinates for d1dqdl2:

Click to download the PDB-style file with coordinates for d1dqdl2.
(The format of our PDB-style files is described here.)

Timeline for d1dqdl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dqdl1