SCOP 1.55: Domain d1dqdl2: 1dqd L:107-214

Lineage for d1dqdl2 (1dqd L:107-214)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab HGR-2 F6, (mouse), kappa L chain [49100] (1 PDB entry)

8. Domain d1dqdl2: 1dqd L:107-214 [21406]
   Other proteins in same PDB: d1dqdh1, d1dqdl1

Details for d1dqdl2

PDB Entry: 1dqd, 2.1 Å

PDB Description: crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor

SCOP Domain Sequences for d1dqdl2:

Sequence; same for both SEQRES and ATOM records:

>d1dqdl2 b.1.1.2 (L:107-214) Immunoglobulin (constant domains of L and H chains) {Fab HGR-2 F6, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrneca

Timeline for d1dqdl2:

• d1dqdl2 appears in SCOP 1.57
  
• d1dqdl2 appears in the current release, SCOPe 2.08