SCOP 1.73: Domain d32c2b2: 32c2 B:120-218

Lineage for d32c2b2 (32c2 B:120-218)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d32c2b2: 32c2 B:120-218 [21405]
   Other proteins in same PDB: d32c2a1, d32c2a2, d32c2b1
   part of the cytochrome P450-arom activity suppressing Fab 32C2

Details for d32c2b2

PDB Entry: 32c2, 3 Å

PDB Description: structure of an activity suppressing fab fragment to cytochrome p450 aromatase

PDB Compounds: (B:) igg1 antibody 32c2

SCOP Domain Sequences for d32c2b2:

Sequence; same for both SEQRES and ATOM records:

>d32c2b2 b.1.1.2 (B:120-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttpppvyplvpgslaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkiep

Timeline for d32c2b2:

• d32c2b2 first appeared (with stable ids) in SCOP 1.55
  
• d32c2b2 appears in SCOP 1.71
  
• d32c2b2 appears in SCOP 1.75
  
• d32c2b2 appears in the current release, SCOPe 2.08