SCOPe 2.06: Domain d3noxb1: 3nox B:40-508

Lineage for d3noxb1 (3nox B:40-508)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)
   automatically mapped to Pfam PF00930

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
   Pfam PF00930

6. Protein automated matches [226889] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225823] (3 PDB entries)

8. Domain d3noxb1: 3nox B:40-508 [214030]
   Other proteins in same PDB: d3noxa2, d3noxb2
   automated match to d1orva1
   complexed with 6a5, gol, nag

Details for d3noxb1

PDB Entry: 3nox, 2.34 Å

PDB Description: crystal structure of human dpp-iv in complex with sa-(+)-(6- (aminomethyl)-5-(2,4-dichlorophenyl)-7-methylimidazo[1,2-a]pyrimidin- 2-yl)(morpholino)methanone

PDB Compounds: (B:) Dipeptidyl-peptidase 4 (CD26, adenosine deaminase complexing protein 2)

SCOPe Domain Sequences for d3noxb1:

Sequence; same for both SEQRES and ATOM records:

>d3noxb1 b.70.3.1 (B:40-508) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d3noxb1:

• d3noxb1 first appeared in SCOPe 2.03
  
• d3noxb1 appears in SCOPe 2.05
  
• d3noxb1 appears in SCOPe 2.07
  
• d3noxb1 appears in the current release, SCOPe 2.08