Lineage for d1cu4h2 (1cu4 H:111-213)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221064Species Anti-prion Fab 3F4, (mouse), kappa L chain [49098] (2 PDB entries)
  8. 221067Domain d1cu4h2: 1cu4 H:111-213 [21403]
    Other proteins in same PDB: d1cu4h1, d1cu4l1

Details for d1cu4h2

PDB Entry: 1cu4 (more details), 2.9 Å

PDB Description: crystal structure of the anti-prion fab 3f4 in complex with its peptide epitope

SCOP Domain Sequences for d1cu4h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cu4h2 b.1.1.2 (H:111-213) Immunoglobulin (constant domains of L and H chains) {Anti-prion Fab 3F4, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprvts

SCOP Domain Coordinates for d1cu4h2:

Click to download the PDB-style file with coordinates for d1cu4h2.
(The format of our PDB-style files is described here.)

Timeline for d1cu4h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cu4h1