Lineage for d1cu4l2 (1cu4 L:108-214)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53358Species Anti-prion Fab 3F4, (mouse), kappa L chain [49098] (2 PDB entries)
  8. 53362Domain d1cu4l2: 1cu4 L:108-214 [21402]
    Other proteins in same PDB: d1cu4h1, d1cu4l1

Details for d1cu4l2

PDB Entry: 1cu4 (more details), 2.9 Å

PDB Description: crystal structure of the anti-prion fab 3f4 in complex with its peptide epitope

SCOP Domain Sequences for d1cu4l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cu4l2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Anti-prion Fab 3F4, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1cu4l2:

Click to download the PDB-style file with coordinates for d1cu4l2.
(The format of our PDB-style files is described here.)

Timeline for d1cu4l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cu4l1