Lineage for d3nntb1 (3nnt B:1-251)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836581Species Salmonella enterica [TaxId:99287] [226761] (5 PDB entries)
  8. 2836585Domain d3nntb1: 3nnt B:1-251 [214017]
    Other proteins in same PDB: d3nnta2, d3nntb2
    automated match to d4h3dd_
    complexed with dqa; mutant

Details for d3nntb1

PDB Entry: 3nnt (more details), 1.6 Å

PDB Description: crystal structure of k170m mutant of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2 in non-covalent complex with dehydroquinate.
PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3nntb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nntb1 c.1.10.0 (B:1-251) automated matches {Salmonella enterica [TaxId: 99287]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipmiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisva
dlrtvltilhq

SCOPe Domain Coordinates for d3nntb1:

Click to download the PDB-style file with coordinates for d3nntb1.
(The format of our PDB-style files is described here.)

Timeline for d3nntb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nntb2