SCOPe 2.04: Domain d3nnnb_: 3nnn B:

Lineage for d3nnnb_ (3nnn B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (54 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [188956] (11 PDB entries)

8. Domain d3nnnb_: 3nnn B: [214013]
   automated match to d2iynb_
   complexed with bef, mg

Details for d3nnnb_

PDB Entry: 3nnn, 2.2 Å

PDB Description: BeF3 Activated DrrD Receiver Domain

PDB Compounds: (B:) DNA binding response regulator d

SCOPe Domain Sequences for d3nnnb_:

Sequence; same for both SEQRES and ATOM records:

>d3nnnb_ c.23.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
nvrvlvvederdladlitealkkemftvdvcydgeegmymalnepfdvvildimlpvhdg
weilksmresgvntpvlmltalsdveyrvkglnmgaddylpkpfdlreliarvralirr

Timeline for d3nnnb_:

• d3nnnb_ first appeared in SCOPe 2.03
  
• d3nnnb_ appears in SCOPe 2.05
  
• d3nnnb_ appears in the current release, SCOPe 2.08