Lineage for d3nnna_ (3nnn A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838070Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1838071Protein automated matches [190131] (59 species)
    not a true protein
  7. 1838288Species Thermotoga maritima [TaxId:2336] [188956] (11 PDB entries)
  8. 1838302Domain d3nnna_: 3nnn A: [214012]
    automated match to d2iynb_
    complexed with bef, mg

Details for d3nnna_

PDB Entry: 3nnn (more details), 2.2 Å

PDB Description: BeF3 Activated DrrD Receiver Domain
PDB Compounds: (A:) DNA binding response regulator d

SCOPe Domain Sequences for d3nnna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nnna_ c.23.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
nvrvlvvederdladlitealkkemftvdvcydgeegmymalnepfdvvildimlpvhdg
weilksmresgvntpvlmltalsdveyrvkglnmgaddylpkpfdlreliarvralirr

SCOPe Domain Coordinates for d3nnna_:

Click to download the PDB-style file with coordinates for d3nnna_.
(The format of our PDB-style files is described here.)

Timeline for d3nnna_: