Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (59 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [188956] (11 PDB entries) |
Domain d3nnna_: 3nnn A: [214012] automated match to d2iynb_ complexed with bef, mg |
PDB Entry: 3nnn (more details), 2.2 Å
SCOPe Domain Sequences for d3nnna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nnna_ c.23.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]} nvrvlvvederdladlitealkkemftvdvcydgeegmymalnepfdvvildimlpvhdg weilksmresgvntpvlmltalsdveyrvkglnmgaddylpkpfdlreliarvralirr
Timeline for d3nnna_: