SCOP 1.57: Domain d1cr9h2: 1cr9 H:111-213

Lineage for d1cr9h2 (1cr9 H:111-213)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Anti-prion Fab 3F4, (mouse), kappa L chain [49098] (2 PDB entries)

8. Domain d1cr9h2: 1cr9 H:111-213 [21401]
   Other proteins in same PDB: d1cr9h1, d1cr9l1

Details for d1cr9h2

PDB Entry: 1cr9, 2 Å

PDB Description: crystal structure of the anti-prion fab 3f4

SCOP Domain Sequences for d1cr9h2:

Sequence; same for both SEQRES and ATOM records:

>d1cr9h2 b.1.1.2 (H:111-213) Immunoglobulin (constant domains of L and H chains) {Anti-prion Fab 3F4, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprvts

Timeline for d1cr9h2:

• d1cr9h2 first appeared (with stable ids) in SCOP 1.55
  
• d1cr9h2 appears in SCOP 1.59
  
• d1cr9h2 appears in the current release, SCOPe 2.08