Lineage for d1cr9h2 (1cr9 H:111-213)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8552Species Anti-prion Fab 3F4, (mouse), kappa L chain [49098] (2 PDB entries)
  8. 8553Domain d1cr9h2: 1cr9 H:111-213 [21401]
    Other proteins in same PDB: d1cr9h1, d1cr9l1

Details for d1cr9h2

PDB Entry: 1cr9 (more details), 2 Å

PDB Description: crystal structure of the anti-prion fab 3f4

SCOP Domain Sequences for d1cr9h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cr9h2 b.1.1.2 (H:111-213) Immunoglobulin (constant domains of L and H chains) {Anti-prion Fab 3F4, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprvts

SCOP Domain Coordinates for d1cr9h2:

Click to download the PDB-style file with coordinates for d1cr9h2.
(The format of our PDB-style files is described here.)

Timeline for d1cr9h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cr9h1