Lineage for d1ejol2 (1ejo L:2112-2216)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656309Domain d1ejol2: 1ejo L:2112-2216 [21398]
    Other proteins in same PDB: d1ejoh1, d1ejoh2, d1ejol1
    part of anti-FMDV Fab 4C4

Details for d1ejol2

PDB Entry: 1ejo (more details), 2.3 Å

PDB Description: fab fragment of neutralising monoclonal antibody 4c4 complexed with g- h loop from fmdv.
PDB Compounds: (L:) igg2a monoclonal antibody (light chain)

SCOP Domain Sequences for d1ejol2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejol2 b.1.1.2 (L:2112-2216) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOP Domain Coordinates for d1ejol2:

Click to download the PDB-style file with coordinates for d1ejol2.
(The format of our PDB-style files is described here.)

Timeline for d1ejol2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ejol1