SCOP 1.59: Domain d1dqmh2: 1dqm H:114-221

Lineage for d1dqmh2 (1dqm H:114-221)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain [49096] (3 PDB entries)

8. Domain d1dqmh2: 1dqm H:114-221 [21397]
   Other proteins in same PDB: d1dqmh1, d1dqml1

Details for d1dqmh2

PDB Entry: 1dqm, 2.1 Å

PDB Description: crystal structure of anti-lysozyme antibody

SCOP Domain Sequences for d1dqmh2:

Sequence; same for both SEQRES and ATOM records:

>d1dqmh2 b.1.1.2 (H:114-221) Immunoglobulin (constant domains of L and H chains) {Anti-lysozyme Fab HYHEL-63, (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkki

Timeline for d1dqmh2:

• d1dqmh2 first appeared (with stable ids) in SCOP 1.55
  
• d1dqmh2 appears in SCOP 1.57
  
• d1dqmh2 appears in SCOP 1.61
  
• d1dqmh2 appears in the current release, SCOPe 2.07